spacer gif spacer gif spacer gif spacer gif ARCHIVE ANNOUNCEMENT! spacer gif
 QUICK SEARCH:   [advanced]


spacer gif
     Home     Help     Feedback     Subscriptions     Archive     Search     Table of Contents    


This Article
Right arrow Summary Freely available
Right arrow Figures Only
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Oldham, S.
Right arrow Articles by Hafen, E.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Oldham, S.
Right arrow Articles by Hafen, E.
Development 129, 4103-4109 (2002)
© 2002 The Company of Biologists Limited

The Drosophila insulin/IGF receptor controls growth and size by modulating PtdInsP3 levels

Sean Oldham1, Hugo Stocker1, Muriel Laffargue2, Franz Wittwer1, Matthias Wymann2 and Ernst Hafen1,*

1 Universität Zürich, Zoologisches Institut, Winterthurerstrasse 190, CH – 8057, Zürich, Switzerland
2 Université de Fribourg, Institute de Biochemie, Rue du Musée 5, CH – 1700, Fribourg, Switzerland

*Author for correspondence (e-mail: hafen{at}zool.unizh.ch)

Accepted 10 June 2002


    SUMMARY
 TOP
 SUMMARY
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Understanding the control of size is of fundamental biological and clinical importance. Insulin/IGF signaling during development controls growth and size, possibly by coordinating the activities of the Ras and PI 3-kinase signaling pathways. We show that in Drosophila mutating the consensus binding site for the Ras pathway adaptor Drk/Grb2 in Chico/IRS does not interfere with growth whereas mutating the binding sites of the PI 3-kinase adaptor p60 completely abrogates Chico function. Furthermore, we present biochemical and genetic evidence that loss of the homolog of the tumor suppressor gene, Pten, results in increased PtdInsP3 levels and that these increased levels are sufficient to compensate for the complete loss of the Insulin/insulin-like growth factor receptor function. This reduction of Pten activity is also sufficient to vastly increase organism size. These results suggest that PtdInsP3 is a second messenger for growth and that levels of PtdInsP3 during development regulate organismal size.

Key words: Growth, PtdInsP3, Pten, Cancer, Tumor suppressor, Insulin, PI 3 kinase


    INTRODUCTION
 TOP
 SUMMARY
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
In Drosophila, the homologs of the mammalian insulin receptor (IR)/insulin-like growth factor receptor (IGFR), InR, and insulin receptor substrates (IRS1-4), Chico, control size (via regulation of growth and proliferation), female fertility, and lipid metabolism during development (Fernandez et al., 1995Go; Chen et al., 1996Go; Böhni et al., 1999Go; Brogiolo et al., 2001Go). Similar to loss of Igf1 or Irs1 function in mice, mutations in positive components of the Drosophila insulin pathway cause a dramatic reduction in size (Liu et al., 1993Go; Araki et al., 1994Go; Tamemoto et al., 1994Go; Stocker and Hafen 2002). Conversely, overexpression of one of the seven Drosophila insulin-like peptides (DILP2) results in flies with increased cell, organ, and body size (Brogiolo et al., 2001Go). Moreover, the increased total lipid levels and female sterility observed in Irs2-deleted and Neuronal Insulin Receptor Knock-Out (NIRKO) mice are also observed in chico mutant flies (Böhni et al., 1999Go; Bruning et al., 2000Go; Burks et al., 2000Go). Thus, the Drosophila InR signaling pathway, in which these processes are combined into a single prototypical pathway consisting of components encoded by single genes, controls physiological processes reminiscent of both the mammalian IR and IGFR systems, thereby demonstrating evolutionary conservation of function (Oldham et al., 2000aGo; Garofalo, 2002Go).

The IR and IGFR act through IRS1-IRS4 proteins, which are multifunctional adaptors that link insulin and IGF signaling to the Ras/MAPK and phosphoinositide 3'-kinase (PI 3-kinase) signaling pathways (Yenush and White, 1997Go). The pleckstrin homology domain (PH) and phosphotyrosine binding domain (PTB) of the IRS proteins are believed to mediate binding to phosphoinositol phosphates and the juxtamembrane NPXY motif of IR/IGFR, respectively (Yenush et al., 1997Go). Drk is the Drosophila homolog of Grb2, an adaptor protein containing SH2 and SH3 domains. It has been suggested that Grb2 may, via its binding to IRS (Olivier et al., 1993Go), link insulin/IGF to the Ras/MAPK pathway and thereby control proliferation (Simon et al., 1993Go; Skolnik et al., 1993Go; Yenush et al., 1997Go). The Drosophila homolog of the SH2 domain containing p85 PI 3-kinase adaptor subunit, p60, binds Chico/IRS and thereby recruits the p110 catalytic subunit of PI 3-kinase [which converts phosphoinositol(4,5)P2 (PtdIns(4,5)P2) into phosphoinositol(3,4,5)P3 (PtdIns(3,4,5)P3)] to the plasma membrane (Leevers et al., 1996Go; Yenush et al., 1997Go; Stambolic et al., 1998Go; Maehama and Dixon, 1999Go; Weinkove et al., 1999Go). The p110 PI 3-kinase belongs to the class I PI 3-kinases implicated in the metabolic effects of insulin (Vanhaesebroeck et al., 2001Go). The classical effectors that mediate the biological outcomes of insulin and IGF downstream of IRS have been divided into two functional branches: the Ras/MAPK proliferation pathway, and the PI 3-kinase metabolic, growth and survival pathway (Yenush et al., 1997Go; Vanhaesebroeck et al., 2001Go).

Hyperactivation of IGF signaling pathways is associated with a wide variety of tumors (Valentinis and Baserga, 2001Go). Components in each of these pathways have been implicated in the initiation and progression of a wide variety of human malignancies. Because both branches are strongly implicated in contributing to tumorigenesis, it is important to determine the relative contribution of each pathway to the processes of growth and proliferation, and thus tumorigenesis. We used two types of approaches to address the relative contribution of the two major effector branches to the processes of growth, proliferation and organismal size control during development. In the first, we analyzed the effects of amino acid substitutions in the different effector sites of the Chico protein. In the second approach, we analyzed the effects of modulating the activity of the PI 3-kinase pathway by genetically altering the levels of PtdInsP3 within the cells. The results obtained from both experimental strategies provide strong evidence that in Drosophila, the PI 3-kinase branch is necessary and sufficient to control InR-mediated growth and proliferation. Furthermore, the results suggest a pivotal role of cellular PtdInsP3 levels in the control of cell growth.


    MATERIALS AND METHODS
 TOP
 SUMMARY
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
Chico effector site mutations
The sites of the mutations in the chico coding region were chosen to substitute important conserved residues that have been determined by structural or biochemical studies carried out in mammalian IRS proteins (Yenush et al., 1997Go). The mutations were introduced using QuickChange (Stratagene) and transgenic lines were established according to the method of Böhni et al. (Böhni et al., 1999Go). The mutants were confirmed by PCR analysis and sequencing. The experiments were carried out with two independent insertion lines for each of the constructs tested.

Mutant analysis
Pten2L100 is a viable hypomorphic mutation located outside of the ORF. Pten2L117 is a strong mutation (5 basepair deletion causing a frameshift at amino acid position 165 resulting in the insertion of 35 new codons (AYKGPKRCDNPISASICSVFFQTSLFKCSIFESKP) before the new stop codon located in the catalytic domain) and behaves similar to a null mutation. These mutations fail to complement other previously identified mutations of Pten and the lethality is rescued by a Pten genomic rescue construct, which identifies them as alleles of Pten. Pten2L100 is a weak temperature-sensitive mutation. Heteroallelic mutants are pupal lethal, but when shifted from 25°C to 18°C during wandering 3rd instar stage allow for viable heteroallelic escapers. Slightly rough eyes, concave wings, and over-enlarged legs are occasionally observed. However, no signs of Ras pathway hyperactivation were observed, such as multiple photoreceptors or extra wing veins. The weighing and metabolic assays were performed according to the methods of Böhni et al. (Böhni et al., 1999Go), except that Pten heteroallelic mutant flies were raised at 18°C.

Fertility and starvation assays
All analyses were performed in a y w background. The fertility assay was performed by mating 15 males and females of the genotype y w; chico1/chico1; P{w+ chicoPH1.1 or chicoPTB7.2 or chicoDrk2.1 or chicoPI3K9 or chicowt4.2 Rescue Construct}/+ and after 1 day of egg laying, the number of pupae was determined. The starvation assay was performed by taking 10-15 freshly eclosed females of the indicated genotypes and placing them in a container with a water-soaked cotton plug. The number of viable flies was determined at each time point.

Metabolic labeling
Briefly, 3rd instar non-wandering larvae were phosphate starved in phosphate-free Schneider S2 medium and then labeled with 2 mCi/sample inorganic 32P (50 mCi/ml; NEN Life Science Products). PtdInsP3 and PtdInsP2 levels were determined as described previously (Arcaro and Wymann, 1993Go).


    RESULTS
 TOP
 SUMMARY
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
To analyze the role of the different domains of Chico/IRS under physiological conditions, a panel of effector site mutants was created in a genomic rescue construct for chico that disrupts the PH or the PTB domains or the putative binding sites of Drk/Grb2 and p60 (Böhni et al., 1999Go) (Fig. 1A). The constructs include the cis-regulatory sequences that permit expression of chico in its normal spatial and temporal pattern. The wild-type chico construct fully restores the defects of chico homozygous null mutants (Böhni et al., 1999Go). In this manner, the effector site mutants were assayed for the ability to rescue the three different phenotypes associated with complete loss of Chico function: body size reduction, female sterility and lipid alterations. The Drk/Grb2 consensus binding site mutant was able to fully rescue the reduced weight to the same extent as the wild-type rescue construct (Fig. 1B). Therefore, the presence of a functional Drk binding site in Chico and thus the link to the activation of the Ras/MAPK kinase pathway is not required for its wild-type function. In contrast, the PH and PTB domain mutants and the double p60 PI 3-kinase binding site mutant were unable to rescue the reduced body weight (Fig. 1B). The latter result is surprising because InR contains additional functional PI 3-kinase binding sites in its C-terminal tail (Yenush et al., 1996Go; Böhni et al., 1999Go), an extension shared only with the C. elegans InR homolog, Daf-2, and not the mammalian IR or IGFR (Kimura et al., 1997Go). This suggests that the presence of additional p60 binding sites in the InR C-terminal tail is not sufficient in vivo to mediate wild-type levels of growth and proliferation in the absence of the Chico p60 PI 3-kinase binding sites and that the InR C-terminal tail may contribute only low levels of PI 3-kinase signaling (Fernandez et al., 1995Go; Chen et al., 1996Go; Yenush et al., 1996Go). Although the PTB domain mutant failed to restore normal body weight, it rescued the female sterility associated with the loss of Chico function (Fig. 1C). With the exception of the full rescue of the lipid accumulation observed in Drk/Grb2 mutant, all the other effectors only partially restored the change in lipid accumulation (Fig. 1D).



View larger version (27K):
[in this window]
[in a new window]
 
Fig. 1. Chico PH, PTB, Drk, and PI 3-kinase effector mutants. (A) The chico genomic rescue construct and the corresponding PH, PTB, Drk, and PI 3-kinase effector consensus site mutants. Numbers indicate amino acid positions (not drawn to scale). (B) The PI 3-kinase, PH and PTB consensus sites are critically required for Chico function in body size control, while the Drk consensus site is dispensable. The weight of male flies carrying the various transgenes was measured as described by Böhni et al. (Böhni et al., 1999Go). (C) The PTB domain is not required for Chico control of female fertility. The number of pupae that developed from eggs laid by an equal number of females of the indicated genotype is shown. (D) All the Chico effectors, except Drk, function in the control of lipid metabolism. All assays were performed three times on at least 10 flies.

 
The inability of the p60 binding site mutant to rescue the size defect indicates that the Chico PI 3-kinase docking sites are necessary for InR/Chico (insulin/IGF) action in size control. However, the issue of whether recruitment of PI 3-kinase to Chico is sufficient to mediate the attainment of wild-type body size is unresolved. It has been reported that overexpression of PI 3-kinase and Akt in Drosophila is sufficient for increased growth but not proliferation (Verdu et al., 1999Go; Weinkove et al., 1999Go). Loss of zygotic InR function results in embryonic lethality with some small arrested larvae, but loss of zygotic Chico function results in viable small flies (Fernandez et al., 1995Go; Chen et al., 1996Go; Böhni et al., 1999Go; Brogiolo et al., 2001Go). Two parsimonious hypotheses could explain this difference. (1) InR activates not only the PI 3-kinase pathway but also another, Chico-independent, signal transduction pathway, or (2) InR signals predominantly through PI 3-kinase, but loss of Chico does not block PI 3-kinase activation completely because of direct interaction of p60 with the InR C-terminal tail. This provides residual PI 3-kinase activation sufficient to rescue viability, but not wild-type size. If the latter hypothesis were true, then increasing PtdInsP3 levels should be sufficient to rescue loss of InR function.

To test whether increasing PtdInsP3 levels in an InR or PI 3-kinase p110 mutant background is sufficient to restore growth, we eliminated the function of a negative regulator of the insulin pathway. The 3'-phosphoinositol-specific lipid phosphatase, PTEN acts as a negative regulator of the PI 3-kinase pathway by converting PtdInsP3 generated by PI 3-kinase into PtdInsP2 (Stambolic et al., 1998Go; Maehama et al., 1999Go). We utilized a null (Pten2L117) and a hypomorphic (Pten2L100) allele of Pten which were identified in a screen for genes involved in growth control (Oldham et al., 2000bGo). As shown by HPLC analysis of the phospholipids in extracts of Pten mutant larvae, the loss of PTEN function results in a 2-fold increase in PtdInsP3 levels (Fig. 2A). This is consistent with the increase in PtdInsP3 seen in Pten-deleted murine fibroblasts (Stambolic et al., 1998Go). One prominent biological effect of these increased PtdInsP3 levels in Drosophila is a substantial increase in size in both larvae and pupae (Fig. 2B). To test whether loss of PTEN function, and consequently increased PtdInsP3 levels, is sufficient to restore growth or viability in InR null mutants, we first generated InR and Pten double mutants by creating mosaic animals using the eyeless-Flipase (eyFlp) tissue-specific recombination system (Newsome et al., 2000Go). In such animals, the head consists of homozygous mutant tissue, whereas the rest of the body is heterozygous for the same mutation. While loss of PTEN function (Pten2L117) in the head results in a fly with a disproportionately larger head (with more and larger cells), loss of InR function (InR327) results in flies with smaller heads (pinhead) compared to the wild type (Fig. 2C,D,E, Fig. 3A). Heads doubly mutant for Pten2L117and InR327, however, are almost the size of heads singly mutant for Pten2L117 (Fig. 2F, Fig. 3A). Secondly, two different lethal heteroallelic InR combinations (InR304/InR327 or InR304/InR25) (Fernandez et al., 1995Go; Chen et al., 1996Go), which arrest at the 2nd larval instar stage, develop to the pupal stage (15-17% of 33% expected) and even to pharate adults in the presence of reduced PTEN levels (Pten2L117/Pten2L100) (Fig. 2G,H). These results demonstrate that complete loss of PTEN function can largely substitute for InR-mediated growth and proliferation in the absence of InR function and that the Ras/MAPK pathway plays little or no role in the InR mediated control of cell growth. This notion is further supported by the observation that complete loss of InR function in the compound eye does not result in a loss of photoreceptors, a hallmark of loss of Ras pathway function (Brogiolo et al., 2001Go).



View larger version (84K):
[in this window]
[in a new window]
 
Fig. 2. Loss of PTEN function rescues InR null mutations. (A) Pten2L117/Pten2L100 mutant larvae have increased PtdInsP3 levels. Data are presented as PtdInsP3:PtdInsP2 ratios and are standardized to the wild-type y w control. The experiment was performed twice with quantitatively similar results. (B) The Pten2L117/Pten2L100 mutant larva (top) is increased in size compared to the y w control. (C) Scanning electromicrograph (SEM) of a dorsal view of a y w control fly. Bar (above C) is 200 µm in all cases. (D) Loss of PTEN function (Pten2L117/Pten2L117) selectively in the head using the eyFlp system (Newsome et al., 2000Go) results in the overproliferation of the head. (E) Loss of InR function (InR327/InR327) selectively in the head using the eyFlp system results in a pinhead. (F) Concomitant loss of InR and PTEN function (Pten2L117/Pten2L117; InR327/InR327) in the head is sufficient to suppress the growth and proliferation defect associated with InR single mutants. (G) The 2nd instar lethality associated with the InR304/InR327 allelic combination is rescued to the pharate adult stage in the Pten2L117/Pten2L100; InR304/InR327 double mutant combination (left). (Right) A y w control. (H) The frequency of rescue to the pupal stage of InR304/InR327 (InR1) (n=15 crosses) and InR304/InR25 (InR2) (n=5 crosses) by the partial loss-of-function Pten2L117/Pten2L100 combination. ‘Expected’ denotes the expected Mendelian frequency for complete rescue to the pupal stage for the genotype: y w; Pten2L117/Pten2L100; InR304/InR327 from the cross (y w; Pten2L117; InR304/Cyo^TM6B x y w; Pten2L100; InR327/Cyo^TM6B).

 


View larger version (137K):
[in this window]
[in a new window]
 
Fig. 3. PtdInsP3 levels control the range of growth and size. (A) Quantification of the eye size of the various mutants. Measurements were made from SEM images by calculating the longest distance of a side view of the eye from dorsal to ventral plus anterior to posterior (n=4-7). The same pattern was also seen when head:thorax ratios were determined from a dorsal view (data not shown). (B) Dorsal view SEM of a y w control fly. Bar above C is 200 µm in all cases. (C) Selective loss of PI 3-kinase p110 function in the head using the eyFlp system results in a strong pinhead phenotype. (D) Loss of PTEN function cannot rescue complete loss of PI 3-kinase p110 function in mosaic clones. The genotype of the fly head shown is Pten2L117/Pten2L117; PI 3-kinasenull/PI 3-kinasenull. (E) Selectively loss of PI 3-kinase p60 function in the head using the eyFlp system results in a strong pinhead phenotype. (F) Loss of PTEN function rescues to wild-type size complete loss of Pi3K p60 function in mosaic clones. The genotype of the fly head shown is Pten2L117/Pten2L117; PI3K p60null/Pi3Kp60null.

 
As increasing PtdInsP3 levels can rescue loss of InR function, these results suggest that the level of PtdInsP3 may be critical in determining the amount of growth. We explored this possibility by examining genetic interactions between Pten and PI 3-kinase p60 and p110. The lethality associated with the complete loss of PI 3-kinase p110 function, cannot be rescued by Pten2L117/Pten2L100 (data not shown). It is possible that without any PI 3-kinase p110 function, PTEN function becomes obsolete. In order to test this possibility, double mosaic clones were generated with the strong loss of function Pten2L117 allele and a null mutation for PI 3-kinase p110 or its p60 adaptor (Weinkove et al., 1999Go). As shown in Fig. 3A,C,D, loss of PTEN function (Pten2L117) is unable to rescue the pinhead phenotype caused by loss of PI 3-kinase p110 function. Clones that are doubly mutant for PI 3-kinase p60 and Pten2L117, however, are of wild-type size (Fig. 3A,B,E,F). In the absence of PI 3-kinase p60 function, PI 3-kinase p110 might have residual activity as suggested by the weaker phenotype of the PI 3-kinase p60 null mutant (Weinkove et al., 1999Go). Indeed, flies doubly mutant for PI 3-kinase p60 and Pten2L117/Pten2L100 flies are viable (data not shown). These data provide strong genetic support for the close relationship between PTEN and PI 3-kinase and indicate that the intracellular levels of PtdInsP3 define the amount of cellular growth.

Because loss of Chico function results in increased lipid levels as well as a dramatic decrease in body size (Böhni et al., 1999Go), we determined whether PTEN might also have a function in metabolic and body size control like Chico. As seen in Fig. 4A,B, partial loss of PTEN function results in flies that are considerably bigger than controls. They weigh approximately 50 percent more than their heterozygous siblings without showing any apparent effect on cell differentiation. The increase in size is due to an increase in both cell size and number as determined by a morphometric analysis of the wing and eye (data not shown). When the levels of lipids and glycogen were measured, a decrease per mass in lipid and glycogen was observed compared to Pten mutant flies rescued by a genomic Pten transgene (Fig. 4C). One biological outcome of this difference is a twofold increase in the rate of mortality under water-only starvation conditions compared to a 2-fold decrease in chico mutant flies (Fig. 4D). Thus lipid and glycogen levels strongly correlate with the survival time under starvation conditions. Since Chico and PTEN activity regulates growth during development and the accumulation of energy stores in the adult, the effects of InR-mediated growth and lipid/glycogen metabolism must diverge downstream of Pten.



View larger version (47K):
[in this window]
[in a new window]
 
Fig. 4. Pten regulates size, metabolism and survival in an opposite manner to positive components of the insulin pathway like Chico. (A) A Pten2L117/Pten2L100 mutant fly (right) compared to the y w control (left). (B) Pten2L117/Pten2L100 mutant flies weigh more than the y w control (data not shown) or to Pten mutants rescued with the Pten genomic rescue construct (n=10). (C) Pten2L117/Pten2L100 mutant flies have decreased glycogen and lipids compared to the y w control (data not shown) or to Pten mutants rescued with the Pten genomic rescue construct (n=10). The glycogen data are transformed by one log10 power. (D) Pten2L117/Pten2L100 mutant flies are hypersensitive to water-only starvation conditions compared to a starvation resistant chico1/chico1 mutant. All assays were performed at least 2 times independently.

 

    DISCUSSION
 TOP
 SUMMARY
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 
In this paper, we have used two approaches to investigate, in Drosophila, the relative contributions of the two main effector pathways activated in response of IR/IGF receptor stimulation, the Ras/MAPK and the PI 3-kinase pathway. First, by mutating the consensus binding sites for the two pathway adaptors, Grb2/Drk and p85/p60, in Chico/IRS we showed that the growth promoting function of Chico is dependent on the p60/p85 binding sites but not on the Drk binding site. These results suggest that recruiting PI 3-kinase but not Drk to Chico is essential for cell and organismal growth. Second, we demonstrate that the growth deficit associated with the loss of InR function is fully compensated by loss of PTEN function. This suggests that the levels of PtdInsP3 in the cell control the amount of cellular growth. Finally, we show that partial loss of PTEN function increases body size and decreases lipid and glycogen stores in the adult suggesting that the levels of PtdInsP3 also control metabolism in the adult.

Viable allelic combinations of insulin receptor pathway components result in at least three characteristic phenotypes: small body size, female sterility and increased lipid content (Chen et al., 1996Go; Böhni et al., 1999Go). The results from the chico effector mutants permit the separation of the three different Chico phenotypes.

(1) Size and fertility. Is there a causal link between the small body size and female sterility? The PTB domain mutant rescues the sterility, but not the size defect, thus separating the growth and the sterility phenotypes. It remains to be resolved whether different levels of PI 3-kinase activation are needed to restore growth and fertility or whether control of fertility involves at least in part the association of Chico with a different receptor which does not require the PTB domain. For the growth regulatory function of Chico, a functional PTB and PH domain are essential. This indicates that in vivo, in the absence of overexpression, these two domains serve non-redundant functions presumably in the localization to the membrane and binding to the insulin/IGF receptor.

(2) Size and lipids. Does the small size cause the increased lipid levels? Chico mutant flies lacking functional p60/PI 3-kinase binding sites, PTB or PH domains are all small, yet the increase in lipid levels is less pronounced than in chico null mutant flies. Also, the Irs2-deleted mice and insulin pathway mutants in C. elegans are not small, yet display increased lipids (Kimura et al., 1997Go; Burks et al., 2000Go). Therefore, there seems to be no direct correlation between developmental growth and energy stores in the adult.

(3) Lipids and sterility. Like chico flies, mice mutant for IRS2 or lacking insulin receptor function in the brain (NIRKO) display increased lipids and are female sterile. Are the increased lipid levels a sign of metabolic dysfunction that leads to the female sterility? The chico PI 3-kinase, PTB and PH effector mutants have similar lipid increases, yet the PTB mutant is fertile while the PI 3-kinase mutant is not. Therefore, there appears to be no direct correlation between lipid accumulation and sterility in Drosophila.

The rescue of lethal, null InR mutant combinations to near viability by reducing PTEN activity strengthens the argument that a PtdInsP3-dependent signaling pathway is the primary effector for InR-derived growth and proliferation. In support of this observation, PI 3-kinase and Akt have been isolated as retroviral oncogenes, suggesting that activation of PI 3-kinase and Akt is sufficient to mediate growth, proliferation, and oncogenesis in vertebrate systems (Bellacosa et al., 1991Go; Chang et al., 1997Go). In Drosophila and mammals, overexpression of PI 3-kinase causes increased growth; but this is not sufficient for proliferation as is removal of Pten (Klippel et al., 1998Go; Goberdhan et al., 1999Go; Huang et al., 1999Go; Weinkove et al., 1999Go; Gao et al., 2000Go). From this premise, it has been proposed that PI 3-kinase and PTEN regulate similar yet distinct pathways (Gao et al., 2000Go). Alternatively, it is possible that they do function uniquely in the same pathway and that the difference may be due to altered location and function because of overexpression, or to differential feedback of PI 3-kinase versus PTEN. For example, as PI 3-kinase has been shown to act as a serine/threonine protein kinase on IRS, this may have a negative feedback effect on the insulin pathway that might not be evident in Pten loss-of-function mutations (Pirola et al., 2001Go). Nevertheless, PI 3-kinase is absolutely critical in controlling size because using an allelic series of PI 3-kinase mutants in combination with the ey-Flp sytem resulted in a range of different head sizes (data not shown). Furthermore, expressing an activated and dominant-negative form of PI 3-kinase in Drosophila imaginal discs or the heart of the mouse also leads to a corresponding increase or decrease in cell and organ size (Weinkove et al., 1999Go; Shioi et al., 2000Go). Thus, the PI 3-kinase/PTEN cycle can be considered a dedicated growth rheostat, and the InR pathway is an evolutionary conserved module for regulating the range of growth and size.

Loss of PTEN function results in a metabolically similar phenotype to loss of murine PTP1B (Ptpn1), an IR-specific tyrosine phosphatase, in that hyperactivation of the IR pathway causes resistance to high-fat-diet-induced obesity because of increased basal metabolism (Elchebly et al., 1999Go; Klaman et al., 2000Go). These metabolic lipid effects have likely been conserved during evolution because the increased lipid levels in chico mutants are reminiscent of the enhanced lipid content in Irs2 deleted and NIRKO mice (Bruning et al., 2000Go; Burks et al., 2000Go).

Collectively, these data firmly establish Drosophila as a valid model organism for the study of metabolic diseases like diabetes and obesity as well as for the study of growth disorders like cancer. Pten mutant flies are larger in size due to increased cell size and number, but have a corresponding decrease in energy stores, a situation completely opposite to mutations in positive components of the insulin signaling pathway like InR, chico, PI 3-kinase, and dAkt. These large viable Pten mutants show that a reduction of PTEN function is sufficient for increased organism size. This fact suggests that the four-fold size difference between viable InR and Pten mutants can simply be controlled by the amount of PtdInsP3 and this phenomenon may possibly be extended to vertebrate size regulation. Thus, in Drosophila, the InR/PI 3-kinase/PTEN pathway combines both metabolism and growth control into one pathway that later diverged into two separate, yet interacting systems in mammals.


    ACKNOWLEDGMENTS
 
We thank L. Montero, J. Reiling, L. Martin, K. Basler, T. Radimerski, J. Montagne, and G. Thomas for critical reading of the manuscript; the Hafen lab for discussion; S. Graham, J. O’Bryan and S. Breuer for help; and S. Leevers and D. Pan for fly stocks. This work was supported by grants from the Swiss National Science Foundation and the Bundesamt für Bildung und Wissenschaft (EU-TMR grant) to E. H, and by a fellowship from the Human Frontiers Science Program (HFSP) to S. O.


    REFERENCES
 TOP
 SUMMARY
 INTRODUCTION
 MATERIALS AND METHODS
 RESULTS
 DISCUSSION
 REFERENCES
 

Araki, E., Lipes, M. A., Patti, M. E., Bruning, J. C., Haag, B., 3rd, Johnson, R. S. and Kahn, C. R. (1994). Alternative pathway of insulin signalling in mice with targeted disruption of the IRS-1 gene. Nature 372, 186-190.[Medline]

Arcaro, A. and Wymann, M. P. (1993). Wortmannin is a potent phosphatidylinositol 3-kinase inhibitor: the role of phosphatidylinositol 3,4,5-trisphosphate in neutrophil responses. Biochem. J. 296, 297-301.

Bellacosa, A., Testa, J. R., Staal, S. P. and Tsichlis, P. N. (1991). A retroviral oncogene, akt, encoding a serine-threonine kinase containing an SH2-like region. Science 254, 274-277.[Abstract/Free Full Text]

Böhni, R., Riesgo-Escovar, J., Oldham, S., Brogiolo, W., Stocker, H., Andruss, B. F., Beckingham, K. and Hafen, E. (1999). Autonomous control of cell and organ size by CHICO, a Drosophila homolog of vertebrate IRS1-4. Cell 97, 865-875.[Medline]

Brogiolo, W., Stocker, H., Ikeya, T., Rintelen, F., Fernandez, R. and Hafen, E. (2001). An evolutionarily conserved function of the Drosophila insulin receptor and insulin-like peptides in growth control. Curr. Biol. 11, 213-221.[Medline]

Bruning, J. C., Gautam, D., Burks, D. J., Gillette, J., Schubert, M., Orban, P. C., Klein, R., Krone, W., Muller-Wieland, D. and Kahn, C. R. (2000). Role of brain insulin receptor in control of body weight and reproduction. Science 289, 2122-2125.[Abstract/Free Full Text]

Burks, D. J., de Mora, J. F., Schubert, M., Withers, D. J., Myers, M. G., Towery, H. H., Altamuro, S. L., Flint, C. L. and White, M. F. (2000). IRS-2 pathways integrate female reproduction and energy homeostasis. Nature 407, 377-382.[Medline]

Chang, H. W., Aoki, M., Fruman, D., Auger, K. R., Bellacosa, A., Tsichlis, P. N., Cantley, L. C., Roberts, T. M. and Vogt, P. K. (1997). Transformation of chicken cells by the gene encoding the catalytic subunit of PI 3-kinase. Science 276, 1848-1850.[Abstract/Free Full Text]

Chen, C., Jack, J. and Garofalo, R. S. (1996). The Drosophila insulin receptor is required for normal growth. Endocrinology 137, 846-856.[Abstract]

Elchebly, M., Payette, P., Michaliszyn, E., Cromlish, W., Collins, S., Loy, A. L., Normandin, D., Cheng, A., Himms-Hagen, J., Chan, C. C. et al.. (1999). Increased insulin sensitivity and obesity resistance in mice lacking the protein tyrosine phosphatase-1B gene. Science 283, 1544-1548.[Abstract/Free Full Text]

Fernandez, R., Tabarini, D., Azpiazu, N., Frasch, M. and Schlessinger, J. (1995). The Drosophila insulin receptor homolog: a gene essential for embryonic development encodes two receptor isoforms with different signaling potential. EMBO J. 14, 3373-3384.[Medline]

Gao, X., Neufeld, T. P. and Pan, D. (2000). Drosophila PTEN regulates cell growth and proliferation through PI3K-dependent and –independent pathways. Dev. Biol. 221, 404-418.[Medline]

Garofalo, R. S. (2002). Genetic analysis of insulin signaling in Drosophila. Trends Endocrinol. Metab. 13, 156-162.[Medline]

Goberdhan, D. C., Paricio, N., Goodman, E. C., Mlodzik, M. and Wilson, C. (1999). Drosophila tumor suppressor PTEN controls cell size and number by antagonizing the Chico/PI3-kinase signaling pathway. Genes Dev. 13, 3244-3258.[Abstract/Free Full Text]

Huang, H., Potter, C. J., Tao, W., Li, D. M., Brogiolo, W., Hafen, E., Sun, H. and Xu, T. (1999). PTEN affects cell size, cell proliferation and apoptosis during Drosophila eye development. Development 126, 5365-5372.[Abstract]

Kimura, K. D., Tissenbaum, H. A., Liu, Y. and Ruvkun, G. (1997). daf-2, an insulin receptor-like gene that regulates longevity and diapause in Caenorhabditis elegans. Science 277, 942-946.[Abstract/Free Full Text]

Klaman, L. D., Boss, O., Peroni, O. D., Kim, J. K., Martino, J. L., Zabolotny, J. M., Moghal, N., Lubkin, M., Kim, Y. B., Sharpe, A. H. et al. (2000). Increased energy expenditure, decreased adiposity, and tissue-specific insulin sensitivity in protein-tyrosine phosphatase 1B-deficient mice. Mol. Cell. Biol. 20, 5479-5489.[Abstract/Free Full Text]

Klippel, A., Escobedo, M. A., Wachowicz, M. S., Apell, G., Brown, T. W., Giedlin, M. A., Kavanaugh, W. M. and Williams, L. T. (1998). Activation of phosphatidylinositol 3-kinase is sufficient for cell cycle entry and promotes cellular changes characteristic of oncogenic transformation. Mol. Cell. Biol. 18, 5699-5711.[Abstract/Free Full Text]

Leevers, S. J., Weinkove, D., MacDougall, L. K., Hafen, E. and Waterfield, M. D. (1996). The Drosophila phosphoinositide 3-kinase Dp110 promotes cell growth. EMBO J. 15, 6584-6594.[Medline]

Liu, J. P., Baker, J., Perkins, A. S., Robertson, E. J. and Efstratiadis, A. (1993). Mice carrying null mutations of the genes encoding insulin-like growth factor I (Igf-1) and type 1 IGF receptor (Igf1r). Cell 75, 59-72.[Medline]

Maehama, T. and Dixon, J. E. (1999). PTEN: a tumour suppressor that functions as a phospholipid phosphatase. Trends Cell Biol. 9, 125-128.[Medline]

Newsome, T. P., Asling, B. and Dickson, B. J. (2000). Analysis of Drosophila photoreceptor axon guidance in eye-specific mosaics. Development 127, 851-860.[Abstract]

Oldham, S., Böhni, R., Stocker, H., Brogiolo, W. and Hafen, E. (2000a). Genetic control of size in Drosophila. Phil. Trans. R. Soc. Lond. B. 355, 945-952.[Medline]

Oldham, S., Montagne, J., Radimerski, T., Thomas, G. and Hafen, E. (2000b). Genetic and biochemical characterization of dTOR, the Drosophila homolog of the target of rapamycin. Genes Dev. 14, 2689-2694.[Abstract/Free Full Text]

Olivier, J. P., Raabe, T., Henkemeyer, M., Dickson, B., Mbamalu, G., Margolis, B., Schlessinger, J., Hafen, E. and Pawson, T. (1993). A Drosophila SH2-SH3 adaptor protein implicated in coupling the sevenless tyrosine kinase to an activator of Ras guanine nucleotide exchange, Sos. Cell 73, 179-191.[Medline]

Pirola, L., Zvelebil, M. J., Bulgarelli-Leva, G., van Obberghen, E., Waterfield, M. D. and Wymann, M. P. (2001). Activation loop sequences confer substrate specificity to phosphoinositide 3-kinase alpha (PI3Kalpha). Functions of lipid kinase-deficient PI3Kalpha in signaling. J. Biol. Chem. 276, 21544-21554.[Abstract/Free Full Text]

Shioi, T., Kang, P. M., Douglas, P. S., Hampe, J., Yballe, C. M., Lawitts, J., Cantley, L. C. and Izumo, S. (2000). The conserved phosphoinositide 3-kinase pathway determines heart size in mice. EMBO J. 19, 2537-2548.[Medline]

Simon, M. A., Dodson, G. S. and Rubin, G. M. (1993). An SH3-SH2-SH3 protein is required for p21Ras1 activation and binds to sevenless and Sos proteins in vitro. Cell 73, 169-177.[Medline]

Skolnik, E. Y., Batzer, A., Li, N., Lee, C. H., Lowenstein, E., Mohammadi, M., Margolis, B. and Schlessinger, J. (1993). The function of GRB2 in linking the insulin receptor to Ras signaling pathways. Science 260, 1953-1955.[Abstract/Free Full Text]

Stambolic, V., Suzuki, A., de la Pompa, J. L., Brothers, G. M., Mirtsos, C., Sasaki, T., Ruland, J., Penninger, J. M., Siderovski, D. P. and Mak, T. W. (1998). Negative regulation of PKB/Akt-dependent cell survival by the tumor suppressor PTEN. Cell 95, 29-39.[Medline]

Tamemoto, H., Kadowaki, T., Tobe, K., Yagi, T., Sakura, H., Hayakawa, T., Terauchi, Y., Ueki, K., Kaburagi, Y. and Satoh, S. (1994). Insulin resistance and growth retardation in mice lacking insulin receptor substrate-1. Nature 372, 182-186.[Medline]

Valentinis, B. and Baserga, R. (2001). IGF-1 receptor signalling in transformation and differentiation. Mol. Pathol. 54, 133-137.[Abstract/Free Full Text]

Vanhaesebroeck, B., Leevers, S. J., Ahmadi, K., Timms, J., Katso, R., Driscoll, P. C., Woscholski, R., Parker, P. J. and Waterfield, M. D. (2001). Synthesis and function of 3-phosphorylated inositol lipids. Annu. Rev. Biochem. 70, 535-602.[Medline]

Verdu, J., Buratovich, M. A., Wilder, E. L. and Birnbaum, M. J. (1999). Cell-autonomous regulation of cell and organ growth in Drosophila by Akt/PKB. Nat. Cell Biol. 1, 500-506.[Medline]

Weinkove, D., Neufeld, T. P., Twardzik, T., Waterfield, M. D. and Leevers, S. J. (1999). Regulation of imaginal disc cell size, cell number and organ size by Drosophila class I(A) phosphoinositide 3-kinase and its adaptor. Curr. Biol. 9, 1019-1029.[Medline]

Yenush, L., Fernandez, R., Myers, M. G., Jr, Grammer, T. C., Sun, X. J., Blenis, J., Pierce, J. H., Schlessinger, J. and White, M. F. (1996). The Drosophila insulin receptor activates multiple signaling pathways but requires insulin receptor substrate proteins for DNA synthesis. Mol. Cell. Biol. 16, 2509-2517.[Abstract]

Yenush, L. and White, M. F. (1997). The IRS-signalling system during insulin and cytokine action. BioEssays 19, 491-500.[Medline]




This article has been cited by other articles:


Home page
DMMHome page
N. J. Oviedo, B. J. Pearson, M. Levin, and A. Sanchez Alvarado
Planarian PTEN homologs regulate stem cells and regeneration through TOR signaling
Dis. Model. Mech., September 1, 2008; 1(2-3): 131 - 143.
[Abstract] [Full Text] [PDF]


Home page
GeneticsHome page
H. McNeill, G. M. Craig, and J. M. Bateman
Regulation of Neurogenesis and Epidermal Growth Factor Receptor Signaling by the Insulin Receptor/Target of Rapamycin Pathway in Drosophila
Genetics, June 1, 2008; 179(2): 843 - 853.
[Abstract] [Full Text] [PDF]


Home page
Am. J. Respir. Cell Mol. Bio.Home page
V. Dave, S. E. Wert, T. Tanner, A. R. Thitoff, D. E. Loudy, and J. A. Whitsett
Conditional Deletion of Pten Causes Bronchiolar Hyperplasia
Am. J. Respir. Cell Mol. Biol., March 1, 2008; 38(3): 337 - 345.
[Abstract] [Full Text] [PDF]


Home page
GeneticsHome page
S. Sugiyama, S. Moritoh, Y. Furukawa, T. Mizuno, Y.-M. Lim, L. Tsuda, and Y. Nishida
Involvement of the Mitochondrial Protein Translocator Component Tim50 in Growth, Cell Proliferation and the Modulation of Respiration in Drosophila
Genetics, June 1, 2007; 176(2): 927 - 936.
[Abstract] [Full Text] [PDF]


Home page
DevelopmentHome page
N. Vereshchagina and C. Wilson
Cytoplasmic activated protein kinase Akt regulates lipid-droplet accumulation in Drosophila nurse cells
Development, December 1, 2006; 133(23): 4731 - 4735.
[Abstract] [Full Text] [PDF]


Home page
J. Cell Sci.Home page
A. Dekanty, S. Lavista-Llanos, M. Irisarri, S. Oldham, and P. Wappner
The insulin-PI3K/TOR pathway induces a HIF-dependent transcriptional response in Drosophila by promoting nuclear localization of HIF-{alpha}/Sima
J. Cell Sci., December 1, 2005; 118(23): 5431 - 5441.
[Abstract] [Full Text] [PDF]


Home page
DevelopmentHome page
W. von Stein, A. Ramrath, A. Grimm, M. Muller-Borg, and A. Wodarz
Direct association of Bazooka/PAR-3 with the lipid phosphatase PTEN reveals a link between the PAR/aPKC complex and phosphoinositide signaling
Development, April 1, 2005; 132(7): 1675 - 1686.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
R. M. Easton, H. Cho, K. Roovers, D. W. Shineman, M. Mizrahi, M. S. Forman, V. M.-Y. Lee, M. Szabolcs, R. de Jong, T. Oltersdorf, et al.
Role for Akt3/Protein Kinase B{gamma} in Attainment of Normal Brain Size
Mol. Cell. Biol., March 1, 2005; 25(5): 1869 - 1878.
[Abstract] [Full Text] [PDF]


Home page
Genes Dev.Home page
J. H. Reiling and E. Hafen
The hypoxia-induced paralogs Scylla and Charybdis inhibit growth by down-regulating S6K activity upstream of TSC in Drosophila
Genes & Dev., December 1, 2004; 18(23): 2879 - 2892.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
D. Papadopoulou, M. W. Bianchi, and M. Bourouis
Functional Studies of Shaggy/Glycogen Synthase Kinase 3 Phosphorylation Sites in Drosophila melanogaster
Mol. Cell. Biol., June 1, 2004; 24(11): 4909 - 4919.
[Abstract] [Full Text] [PDF]


Home page
GeneticsHome page
J. K. Inlow and L. L. Restifo
Molecular and Comparative Genetics of Mental Retardation
Genetics, February 1, 2004; 166(2): 835 - 881.
[Abstract] [Full Text] [PDF]


Home page
Mol. Cell. Biol.Home page
M. Miron, P. Lasko, and N. Sonenberg
Signaling from Akt to FRAP/TOR Targets both 4E-BP and S6K in Drosophila melanogaster
Mol. Cell. Biol., December 15, 2003; 23(24): 9117 - 9126.
[Abstract] [Full Text] [PDF]


Home page
Hum Mol GenetHome page
D. C.I. Goberdhan and C. Wilson
PTEN: tumour suppressor, multifunctional growth regulator and more
Hum. Mol. Genet., October 15, 2003; 12(90002): R239 - 248.
[Abstract] [Full Text] [PDF]


This Article
Right arrow Summary Freely available
Right arrow Figures Only
Right arrow Full Text (PDF)
Right arrow Alert me when this article is cited
Right arrow Alert me if a correction is posted
Services
Right arrow Email this article to a friend
Right arrow Similar articles in this journal
Right arrow Similar articles in PubMed
Right arrow Alert me to new issues of the journal
Right arrow Download to citation manager
Right arrow reprints & permissions
Citing Articles
Right arrow Citing Articles via HighWire
Right arrow Citing Articles via Google Scholar
Google Scholar
Right arrow Articles by Oldham, S.
Right arrow Articles by Hafen, E.
Right arrow Search for Related Content
PubMed
Right arrow PubMed Citation
Right arrow Articles by Oldham, S.
Right arrow Articles by Hafen, E.